PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10023177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family S1Fa-like
Protein Properties Length: 90aa    MW: 9846.61 Da    PI: 10.4765
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10023177genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA1321.6e-412389470
         S1FA  4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                 + +eakG+nPGlivllv+g+l+l fl+gny+ly+yaqk+lP rkkkPvskkk+kre+lkqGv++PGe
  Lus10023177 23 KDAEAKGFNPGLIVLLVIGTLVLAFLIGNYALYMYAQKTLPARKKKPVSKKKMKRERLKQGVSAPGE 89
                 679***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0190135.0E-72189No hitNo description
PfamPF046892.1E-402589IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MSDDSEFADH STPSFERMGK AMKDAEAKGF NPGLIVLLVI GTLVLAFLIG NYALYMYAQK  60
TLPARKKKPV SKKKMKRERL KQGVSAPGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8295841e-142EU829584.1 Linum usitatissimum clone LU0015D12 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525167.12e-34PREDICTED: DNA-binding protein S1FA
SwissprotP425531e-17S1FA1_ORYSJ; DNA-binding protein S1FA1
TrEMBLB9SGP82e-34B9SGP8_RICCO; DNA-binding protein S1FA, putative
STRINGPOPTR_0016s08890.19e-30(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54093355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37120.12e-09S1FA-like DNA-binding protein